PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002763
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 94aa    MW: 10602.1 Da    PI: 9.8697
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002763genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.94.8e-322676151
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                 krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g+lyey++
  Lus10002763 26 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYAN 76
                 79***********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-411877IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.5711878IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-301978IPR002100Transcription factor, MADS-box
CDDcd002657.73E-401978No hitNo description
PRINTSPR004048.0E-342040IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002074IPR002100Transcription factor, MADS-box
PfamPF003193.1E-272774IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-344055IPR002100Transcription factor, MADS-box
PRINTSPR004048.0E-345576IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSGYQSDSRE DSPSQRKIGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDAEI  60
ALIVFSSRGR LYEYANNSSS FHLQILIGGM DQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-211877160Myocyte-specific enhancer factor 2B
1tqe_Q1e-211877160Myocyte-specific enhancer factor 2B
1tqe_R1e-211877160Myocyte-specific enhancer factor 2B
1tqe_S1e-211877160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576689.12e-43PREDICTED: floral homeotic protein AGAMOUS
SwissprotQ435852e-42AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLG8FUQ22e-42G8FUQ2_MANIN; AGAMOUS-like protein
STRINGPGSC0003DMT4000731346e-40(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-30MIKC_MADS family protein